DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:250 Identity:59/250 - (23%)
Similarity:93/250 - (37%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPAIYYVLMEIILPELSDY-------W---SPGYVFQLLLG----LFLFSNVMSNYVMCILVDPS 77
            ||:::.....::|...|..       |   :..:.|.::.|    |..||.|..|:     .||.
Human    26 LPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNF-----SDPG 85

  Fly    78 IDPKLMKNQ---------LVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCC 133
            |..:....|         :..|.....|  |.||....|||:.||..|.:||...||||.:...|
Human    86 ILHQGSAEQGPLTVHVVWVNHGAFRLQW--CPKCCFHRPPRTYHCPWCNICVEDFDHHCKWVNNC 148

  Fly   134 IGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFK 198
            |||.|:|:|...::...|.....|.:..||          |...||...::....::::.:....
Human   149 IGHRNFRFFMLLVLSLCLYSGAMLVTCLIF----------LVRTTHLPFSTDKAIAIVVAVSAAG 203

  Fly   199 LPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNF 253
            |  :..|...|:...|.:.....||....:..:||         .|||:....|:
Human   204 L--LVPLSLLLLIQALSVSSADRTYKGKCRHLQGY---------NPFDQGCASNW 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 20/45 (44%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 28/83 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.