DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc14

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_004914695.1 Gene:zdhhc14 / 100489334 XenbaseID:XB-GENE-998053 Length:481 Species:Xenopus tropicalis


Alignment Length:340 Identity:72/340 - (21%)
Similarity:122/340 - (35%) Gaps:118/340 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IYYVLMEIIL-----------PELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPKL- 82
            ::|:.:.:||           |.|:...:|  ...::.|:.:|. ||...:.....||.:.|:. 
 Frog    55 VFYLTLILILVTSGLFFAFDCPYLAVKITP--AIPVIGGILVFF-VMGTLLRTSFSDPGVLPRAT 116

  Fly    83 ---------------------------MKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCV 120
                                       .|..::.|| :.....|..|.|..|||:.||..|..||
 Frog   117 PDEAADLERQIDVANGSTSGGYRPPPRTKEVVINGQ-TVKLKYCFTCKIFRPPRASHCSLCDNCV 180

  Fly   121 LMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTH---PAP 182
            ...||||.:.|.|:|..|||:|:.|:        :||:..::||:.        |::||   .:.
 Frog   181 ERFDHHCPWVGNCVGKRNYRFFYMFI--------LSLSFLTVFIFA--------FVITHVILRSQ 229

  Fly   183 NSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAY-------------DQWS--RG 232
            .|.:.|:|       |......|...:.|..:|..|.::.:..|             ..||  ||
 Frog   230 QSGFLNAL-------KDSPASVLEAVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSSKRG 287

  Fly   233 YFCYD-FELQNIPFDRKLRRNFK------------TFLGRRMKWTWISGFVPSQLDH-----DGF 279
            ...|: :...||         ||            :.:.||       ||||:.:..     :|.
 Frog   288 KENYNPYSYGNI---------FKNCCAALCGPVNPSLIDRR-------GFVPADMPQAVSPSNGL 336

  Fly   280 DLDPDNERVADWCSE 294
            .:....:..::.|.:
 Frog   337 TMYGSTQSQSNMCDQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
zdhhc14XP_004914695.1 DHHC 156..279 CDD:366691 39/145 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.