DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and slc66a1l

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001123690.1 Gene:slc66a1l / 100170445 XenbaseID:XB-GENE-5794175 Length:303 Species:Xenopus tropicalis


Alignment Length:157 Identity:35/157 - (22%)
Similarity:60/157 - (38%) Gaps:43/157 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LHGGRYQLFMLTHPAPNSAYFNSLIIRII------YFKLPDIY--------ELVFTLVFVLLWIG 217
            |.|..:...:|.....|:..:.|:|:.::      :..||.:|        :...:|.|:|.|:|
 Frog    22 LEGSPWIWQLLQQCVENAWEYWSVIVGLVSIACFLFAALPQLYVAHTNGRVDQALSLGFLLCWLG 86

  Fly   218 -------VCVAT------------YVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKW 263
                   .|..|            ||..|......|.| ::|:|    .:|:.| .:..|..:.|
 Frog    87 GDFTNFIGCYLTNQLPLQIITAIFYVNMDIIMISQFSY-YKLKN----NRLKGN-GSLKGICISW 145

  Fly   264 T----WISGFVPSQLDHDGFDLDPDNE 286
            .    .:|..:||||....:|.:.|.|
 Frog   146 VLLAITLSILLPSQLLLKKYDKNTDVE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066
slc66a1lNP_001123690.1 PQ-loop 44..103 CDD:282099 12/58 (21%)
PQ-loop 185..238 CDD:282099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.