Sequence 1: | NP_652670.2 | Gene: | CG18810 / 59171 | FlyBaseID: | FBgn0042133 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121854.1 | Gene: | zdhhc17 / 100148543 | ZFINID: | ZDB-GENE-070424-194 | Length: | 620 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 57/232 - (24%) |
---|---|---|---|
Similarity: | 83/232 - (35%) | Gaps: | 82/232 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMI-------- 155
Fly 156 ---------SLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVF 211
Fly 212 VLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDH 276
Fly 277 -------DGFDLD--------PDNERVADWCSETTIK 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18810 | NP_652670.2 | zf-DHHC | 92..>138 | CDD:303066 | 17/38 (45%) |
zdhhc17 | NP_001121854.1 | PHA02874 | <59..>253 | CDD:165205 | |
ANK repeat | 77..108 | CDD:293786 | |||
ANK 1. /evidence=ECO:0000255 | 77..106 | ||||
ANK repeat | 110..142 | CDD:293786 | |||
ANK 2. /evidence=ECO:0000255 | 111..140 | ||||
ANK repeat | 144..175 | CDD:293786 | |||
ANK 3. /evidence=ECO:0000255 | 144..173 | ||||
Ank_2 | 150..243 | CDD:403870 | |||
ANK repeat | 177..209 | CDD:293786 | |||
ANK 4. /evidence=ECO:0000255 | 177..207 | ||||
ANK repeat | 212..243 | CDD:293786 | |||
ANK 5. /evidence=ECO:0000255 | 212..241 | ||||
ANK 6. /evidence=ECO:0000255 | 245..274 | ||||
DHHC | 426..556 | CDD:396215 | 42/169 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |