DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc17

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001121854.1 Gene:zdhhc17 / 100148543 ZFINID:ZDB-GENE-070424-194 Length:620 Species:Danio rerio


Alignment Length:232 Identity:57/232 - (24%)
Similarity:83/232 - (35%) Gaps:82/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMI-------- 155
            |..|.|..|.||:||..|..|:...||||.:.|.|:|..|:|||..:|  |||.|||        
Zfish   427 CSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYL--FFLLCMICWMMYGCI 489

  Fly   156 ---------SLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVF 211
                     |.|....:||:           |..|..|               |.::.:....||
Zfish   490 CYWRIHCATSYTKDGFWIYI-----------TQIATCS---------------PWMFWMFLNSVF 528

  Fly   212 VLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDH 276
            ..:|:.|.:             .|..:::..:......|.|.:.:  :..|.|..|  :.|..:|
Zfish   529 HFMWVAVLI-------------MCQLYQIAVLGITTNERMNARRY--KHFKVTATS--IESPFNH 576

  Fly   277 -------DGFDLD--------PDNERVADWCSETTIK 298
                   |.|:|.        |     .||.|:.||:
Zfish   577 GCMRNLIDFFELRCCGLLRPVP-----IDWTSQYTIE 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/38 (45%)
zdhhc17NP_001121854.1 PHA02874 <59..>253 CDD:165205
ANK repeat 77..108 CDD:293786
ANK 1. /evidence=ECO:0000255 77..106
ANK repeat 110..142 CDD:293786
ANK 2. /evidence=ECO:0000255 111..140
ANK repeat 144..175 CDD:293786
ANK 3. /evidence=ECO:0000255 144..173
Ank_2 150..243 CDD:403870
ANK repeat 177..209 CDD:293786
ANK 4. /evidence=ECO:0000255 177..207
ANK repeat 212..243 CDD:293786
ANK 5. /evidence=ECO:0000255 212..241
ANK 6. /evidence=ECO:0000255 245..274
DHHC 426..556 CDD:396215 42/169 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.