DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc22

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001340992.2 Gene:zdhhc22 / 100000886 ZFINID:ZDB-GENE-131127-476 Length:280 Species:Danio rerio


Alignment Length:289 Identity:74/289 - (25%)
Similarity:113/289 - (39%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AIYYVLMEIILPELSDYW-SPGYVFQLLLGLFLFSNVMSNYVMCI-------------LVDPSID 79
            |::::|....:.:.||.. :|..:..:.:.|||..|.:.||:|.|             :..|...
Zfish    28 ALHFLLFTPTIFQSSDVTINPAMLAHISIFLFLMGNALGNYIMTIRNPSESANETVIPVCSPDCP 92

  Fly    80 PKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFY 144
            .::..:.|:.|:|                   .|:.|...:|.|||||||||.|||:.|.|||..
Zfish    93 DRIDAHYLLNGRH-------------------FCKVCKKVILKRDHHCFFTGNCIGNRNMRYFIM 138

  Fly   145 FLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLI-IRIIYFKLPDIYELVFT 208
            |.||...||:.||.....::.:.:...::         |...|.:|: :...||.|..|..|.|.
Zfish   139 FSIYTSSSCLYSLVIGVAYLTIEYSISFE---------NPLTFLTLLPLSTGYFFLGLISGLQFF 194

  Fly   209 LVFVL-LWIGVCVATYVAYDQWSRGYFCYDF----------ELQNIPFDR---KLRRNFKTFLGR 259
            ||.:| :|:|:.:.        |.|:.|...          |||......   ..|.|.....|.
Zfish   195 LVIMLYIWLGIGLV--------SVGFCCQQLLLVARGQTWCELQKGQLSECRGTWRANLTDVFGS 251

  Fly   260 RMKWTWISG-FVPS----------QLDHD 277
            .    |:.| |||.          |:.||
Zfish   252 H----WVLGLFVPVPTVETVPGNWQVYHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 16/45 (36%)
zdhhc22XP_001340992.2 zf-DHHC 105..233 CDD:307600 47/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.