DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18808 and CG10512

DIOPT Version :9

Sequence 1:NP_652668.1 Gene:CG18808 / 59169 FlyBaseID:FBgn0042131 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_649289.2 Gene:CG10512 / 40339 FlyBaseID:FBgn0037057 Length:446 Species:Drosophila melanogaster


Alignment Length:361 Identity:140/361 - (38%)
Similarity:204/361 - (56%) Gaps:15/361 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TQQRGDTSLVLVDEARRFIQDCLLRVGVSPSKVRCISEFLVVADYRGNYGSGLNRLDYYLSDLQS 89
            |.......||.|.|:|||:.||...|.|..:.....::.||.||:||::..|:|||:.|::||..
  Fly    85 TMSAAAPKLVAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMYINDLAI 149

  Fly    90 GHAKVGAEPSIISETVSTAHVNGNSALGVFVGNFCMDLAVKKAEDSGIGFVVAQQSHDIGMASWF 154
            ......|.|.|:.||.:||.|:|.:.||..|||:|||||:|||:..|:|:|.|:.|:..|||.|:
  Fly   150 NSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWY 214

  Fly   155 TFRAAGKGLAGIVMSNSAPTMMGPNSKSASIGSNCF---AFCVKGEEYHFVLDMATSVKDIGAVE 216
            ..||..:||.|:.|:|::|.|....:|.|::|:|..   |....|::  |:|||||:...:|.:|
  Fly   215 AIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPLSLGANATNGDK--FLLDMATTAVAVGKIE 277

  Fly   217 WAWANDEYIPHGWAANEGGLSTCFPSLALRTPLLFPAG------GHKGYCLSAVIDILCGVLSGA 275
            ........:|.|||.:..|..|....|...|..|.|.|      |:|||.|.|::|||.||:|||
  Fly   278 IQRRKGAPLPDGWAQDPSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGA 342

  Fly   276 QYATHIT----MDQNQPSNLGQVFIALDPEFFLPNFMERFDDFCGRIQNSQPADDSEPIRLPGEL 336
            .|:|.:.    ...:..::|||||||:||..|.|||.||..||..|::.:.|.|.|:|:.|.|:.
  Fly   343 NYSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGATPTDPSKPVLLAGDK 407

  Fly   337 ERMHMNYVEDLRALAYPNSLLTKYKEVAERLCVKPI 372
            |:..|..|:....:.|..:.|.....:||.|.:||:
  Fly   408 EKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18808NP_652668.1 Ldh_2 38..341 CDD:280734 127/315 (40%)
CG10512NP_649289.2 PLN00105 100..432 CDD:215057 130/333 (39%)
Ldh_2 100..408 CDD:280734 125/309 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448871
Domainoid 1 1.000 141 1.000 Domainoid score I217
eggNOG 1 0.900 - - E1_COG2055
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I231
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1122265at2759
OrthoFinder 1 1.000 - - FOG0008534
OrthoInspector 1 1.000 - - otm51429
orthoMCL 1 0.900 - - OOG6_104354
Panther 1 1.100 - - P PTHR11091
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.