DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and VHT1

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:319 Identity:63/319 - (19%)
Similarity:98/319 - (30%) Gaps:85/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVAVRLLVGICEGPCFPA 214
            |.::..:|...|..|:....:|....|.   .|..|....|...|..|.|.|.::.......:|.
Yeast   176 GAIVFQLPFMYLLPRFPSHIILPVMDLG---WTWFTFACYRANSLAELRAYRFILSAFGAAYYPV 237

  Fly   215 VCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLL-------------IAEQDWPVFFYLV 266
            ...:|..|....|..........|.::|    .:.||||             :|...|   .:|:
Yeast   238 SQYILGCWYAPDEINSRVCLFFCGQQLG----SVTSGLLQSRIFKSLNGVHGLAGWRW---MFLI 295

  Fly   267 GGGAVAW---FLGFTLV------CYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGED 322
            ...|::.   .:||.::      |||.     |:..||....|.....:.:            :|
Yeast   296 DAIAISLPTAIIGFFVIPGVPSKCYSL-----FLTDEEIRIARARNKRNQI------------KD 343

  Fly   323 GYEGE------DREHRREVEAT--------CNTAPWRSML---NSTPLWALVSTS---MQQEFQQ 367
            |.:..      .|:..::|..|        .:|..|.:|.   .|..||...:|.   .|.....
Yeast   344 GVDKSKLAPLWSRKLWKKVFCTPAFWVLVVFDTCSWNNMTAYSGSYTLWLKSNTKYSIAQVNNLS 408

  Fly   368 KLPQELQIALEEVRARGTS-------FSELTTIIETIA---------PSVGNWIASLTT 410
            .:|..|..|.....|.|..       |.....|:.|::         ||...|.|..||
Yeast   409 VIPACLGFAYVIFCAFGADLFRCKWIFMVFAAIMNTVSCALLIKWDIPSKAKWYAFFTT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 29/145 (20%)
MFS_1 135..498 CDD:284993 63/319 (20%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 63/319 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.