DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and YCT1

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_013045.1 Gene:YCT1 / 850671 SGDID:S000003978 Length:531 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:61/304 - (20%)
Similarity:107/304 - (35%) Gaps:72/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RQTQSLVVMAFYAGYVLSHVPGGRLAERYG-GKWVLSAAILTSAVLTLLTPTAVRQGGLYALVAV 200
            :.|.:.|...||.|:.:...||..||::.. ||: |...:.|..:|..|:.||....|   :||:
Yeast    93 QNTYNTVNTLFYVGFAIGQFPGQYLAQKLPLGKF-LGGLLATWTILIFLSCTAYNFSG---VVAL 153

  Fly   201 RLLVGICEGPCFPAVCALLAQWVPEQERG-----MLASCV---LSGGEIGITMVQLVSGLLIAEQ 257
            |..:|:.|....|.:...:..:....||.     ..|:|:   :..|.|...::.:.:..:..  
Yeast   154 RFFLGLTESVVIPILITTMGMFFDASERAAAQPFFFAACMGSPIPTGFIAYGVLHITNPSISL-- 216

  Fly   258 DWPVFFYLVGG-------GAVAWFLGFTLVCYSTPDHCPFIQSEEREYI--RCNTSNSFLLTTGR 313
             |.:|..::||       ..:.||       .:.|....|...:||.:|  |...|      ||.
Yeast   217 -WKIFTIIIGGLTFIMTVVVILWF-------PNNPADVKFFSIQERVWIIRRVQAS------TGS 267

  Fly   314 EREEMDGEDGYEGEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIALE 378
            ..|                   :.....:.:|..:.....|......:.|:....||.:..:..|
Yeast   268 SIE-------------------QKVFKKSQFREAMKDYITWLFGLFFLLQQLANNLPYQQNLLFE 313

  Fly   379 E-----------VRARGTSFSELTTIIETIAPSVGNW--IASLT 409
            .           |...|..|:.:...|.|:  .:..|  |::||
Yeast   314 GMGGVDALGSTLVSVAGAGFAVVCAFIATL--MLAKWKNISALT 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 36/158 (23%)
MFS_1 135..498 CDD:284993 61/304 (20%)
YCT1NP_013045.1 MFS_FEN2_like 54..462 CDD:340885 61/304 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.