DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a6

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_445879.1 Gene:Slc17a6 / 84487 RGDID:620531 Length:582 Species:Rattus norvegicus


Alignment Length:441 Identity:113/441 - (25%)
Similarity:190/441 - (43%) Gaps:89/441 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVR--QGGLYAL 197
            |..:|..::..:|:.||:::.:|||.:|.|.....|..||||.::.|.:|.|:|.|  .|   .:
  Rat   119 WDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYG---CV 180

  Fly   198 VAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVF 262
            :.||:|.|:.||..:||...:.::|.|..||..||:....|...|..:...::|:|:....|...
  Rat   181 IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSV 245

  Fly   263 FYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGE 327
            ||:.|...:.|::.:.||.|.:|...|.|..|||.||..:...|..|....|:.:          
  Rat   246 FYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK---------- 300

  Fly   328 DREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIA-LEEVRARGTS----F 387
                          .|||....|.|::|::..:..:.:...|....|.| .|||.....|    .
  Rat   301 --------------TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGML 351

  Fly   388 SELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCG------------ 440
            |.:..::.||...:|        |:::|.|..:|||:.|..|::|:     ||            
  Rat   352 SAVPHLVMTIIVPIG--------GQIADFLRSKQILSTTTVRKIMN-----CGGFGMEATLLLVV 403

  Fly   441 ----------SMYMLQIKMSGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPAL 495
                      |..:|.:..||   :::.|....:       ||::|.||..|||||.|:|.|..:
  Rat   404 GYSHTRGVAISFLVLAVGFSG---FAISGFNVNH-------LDIAPRYASILMGISNGVGTLSGM 458

  Fly   496 LMPYL----------EQLETDYKLVSSVRAAMWVIGASYISGDVQAFNQPE 536
            :.|.:          |:.:..:.:.:.|.....:..|.:.||:.|.:..||
  Rat   459 VCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWADPE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 44/146 (30%)
MFS_1 135..498 CDD:284993 104/391 (27%)
Slc17a6NP_445879.1 2A0114euk 70..511 CDD:129972 113/441 (26%)
MFS 75..498 CDD:119392 108/428 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.