DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a4

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001258143.1 Gene:Slc17a4 / 679784 RGDID:1584758 Length:495 Species:Rattus norvegicus


Alignment Length:425 Identity:109/425 - (25%)
Similarity:187/425 - (44%) Gaps:70/425 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EDSQERLSCSEQWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPT 187
            |..||..:....|..:.|.:::.:...|..|:.:|.|.:|..:|.|:|:...:|.|:||||..|.
  Rat    91 ETLQESKAPVYDWTPEIQGILLSSLNYGSFLAPIPTGYVAGVFGAKYVVGLGLLVSSVLTLFIPL 155

  Fly   188 AVRQGGLYALVAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGL 252
            |. :.|:..|:.:|::.|:.:........::.|:|.|..||..|.:...||..:|..:|.:..||
  Rat   156 AA-EAGVALLIVLRVIQGMSQVMVLTGQYSMWAKWAPPLERSQLITIAASGSMLGTFLVLIAGGL 219

  Fly   253 LIAEQDWPVFFYLVGG-GAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGRERE 316
            |.....||..||:.|| |.....|.|.|| |..|.:.|||.:.|:.||.|:.:.           
  Rat   220 LCQALGWPYIFYIFGGIGCACCLLWFPLV-YDDPQNHPFISTGEKRYIMCSLAQ----------- 272

  Fly   317 EMDGEDGYEGEDREHRREVEATCN---TAPWRSMLNSTPLWALVSTSMQQ-----EFQQKLPQEL 373
                      ||          |:   :.|.::|:.|.||||:|.:...:     ......|..:
  Rat   273 ----------ED----------CSLGWSLPIKAMVKSLPLWAIVVSYFCEYWLLFTIMAYTPTYI 317

  Fly   374 QIALE-EVRARGTSFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVF 437
            ...|: .:|..|         |.:..|.:...:..:..|.|:|.|:.:.||.....|:|.:.|..
  Rat   318 SSVLQANLRDSG---------ILSALPFMFGCVCIILGGLLADFLLSRNILRLVTIRKLFTALGV 373

  Fly   438 LCGSMYMLQ---IKMSGARIWSVLGMGAYYASI----KLLP-LDMSPNYAGTLMG-------ISG 487
            |..|..::.   :..|.:...:.|.:.:.:||:    .|:. ||::|.|||.|.|       ::|
  Rat   374 LVSSGILVPLPWVSSSLSTTMAFLVLSSVFASLCDSGALINFLDIAPRYAGFLKGLLQVFSYLAG 438

  Fly   488 GMGALPALLMPYLEQ-LETDYKLVSSVRAAMWVIG 521
            |:.  |.:...::.| .|..::.|..:.||:.|:|
  Rat   439 GIA--PTVAGFFISQDSEFGWRNVFLLAAAIDVVG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 44/151 (29%)
MFS_1 135..498 CDD:284993 99/387 (26%)
Slc17a4NP_001258143.1 MFS_SLC17 40..479 CDD:340876 109/425 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.