DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and SLC17A1

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_016866688.1 Gene:SLC17A1 / 6568 HGNCID:10929 Length:517 Species:Homo sapiens


Alignment Length:388 Identity:97/388 - (25%)
Similarity:169/388 - (43%) Gaps:66/388 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |....|.:::.:...|.::..||.|..:..|..|.::..|:..|:||:||.|.|...|..:.:|.
Human   125 WSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAWVVVC 189

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFFY 264
             |.:.|..:|....|...:..:|.|..|||.|.|...||..:|..:|.||:|::.....||:.||
Human   190 -RAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFY 253

  Fly   265 LVG--GGAVA--WFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYE 325
            :.|  |.||.  ||:.|    |..|...|.|...|:|||     .|.|:                
Human   254 IFGACGCAVCLLWFVLF----YDDPKDHPCISISEKEYI-----TSSLV---------------- 293

  Fly   326 GEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKL-----PQELQIALEEVRARGT 385
                   ::|.::..:.|.:::|.|.|:||:.:.|....:...:     |..:...| .|..:..
Human   294 -------QQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSML-HVNIKEN 350

  Fly   386 SFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCGSMYMLQIKMS 450
            .|  |:::     |.:..||.....|:|||..:.:.||:....|:|.:...||..:::.:.:...
Human   351 GF--LSSL-----PYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYL 408

  Fly   451 GARIWSVL-------GMGAY-YASIKLLPLDMSPNYAG------TLMGISGGM--GALPALLM 497
            .:..:|::       ..|:: ...:.:..||::|.|.|      ||.|:.||:  ..|..|::
Human   409 SSTFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLIL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 47/148 (32%)
MFS_1 135..498 CDD:284993 97/388 (25%)
SLC17A1XP_016866688.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.