DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and SLC17A9

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_071365.4 Gene:SLC17A9 / 63910 HGNCID:16192 Length:436 Species:Homo sapiens


Alignment Length:386 Identity:98/386 - (25%)
Similarity:156/386 - (40%) Gaps:81/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTP--TAVRQGGLYAL 197
            |.::...:|:.:|:.||.|:.|.||.|.:|.||:.|:..:......:|.:||  ..:....|..:
Human    57 WNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAFM 121

  Fly   198 VAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVF 262
            ...|:|:|:.:|..|||:.:||:|.|.|.||....|.|.:|.:.|..:...|..||:....|...
Human   122 TFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEWYGWQSI 186

  Fly   263 FYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGE 327
            ||..||..:.|      |.|.    ..::.||:          ..:|..           |...:
Human   187 FYFSGGLTLLW------VWYV----YRYLLSEK----------DLILAL-----------GVLAQ 220

  Fly   328 DREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIALEEVRARGTSF----S 388
            .|...|.     |..|||.:.....:||.|.:.:                    :...||    |
Human   221 SRPVSRH-----NRVPWRRLFRKPAVWAAVVSQL--------------------SAACSFFILLS 260

  Fly   389 ELTTIIETIAPSVGNWI-----------ASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCGSM 442
            .|.|..|...|....||           |||.:|.|||.||.|.....| .|:||..:.....|:
Human   261 WLPTFFEETFPDAKGWIFNVVPWLVAIPASLFSGFLSDHLINQGYRAIT-VRKLMQGMGLGLSSV 324

  Fly   443 YMLQIKMSGARIWSV------LGMGAY-YASIKLLPLDMSPNYAGTLMGISGGMGALPALL 496
            :.|.:..:.:...||      :|:..: ::.|.:...|::|:.||.|.|::...|||..::
Human   325 FALCLGHTSSFCESVVFASASIGLQTFNHSGISVNIQDLAPSCAGFLFGVANTAGALAGVV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 45/146 (31%)
MFS_1 135..498 CDD:284993 98/386 (25%)
SLC17A9NP_071365.4 MFS_1 44..386 CDD:311564 98/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.