DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and si:ch1073-513e17.1

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005159826.1 Gene:si:ch1073-513e17.1 / 571066 ZFINID:ZDB-GENE-030131-7188 Length:508 Species:Danio rerio


Alignment Length:495 Identity:134/495 - (27%)
Similarity:221/495 - (44%) Gaps:82/495 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RIELAMAL----NHTEYQLRSRLKAGKEQPDLNQISAKGTRDRE-PAGEKRPGQEDSQERLSCSE 133
            |:.|::|:    |.|..|..|......|.|..:......::..| |.|..|             .
Zfish    59 RVNLSVAMVAMVNGTNDQPSSNSSISNECPAPSPAHNNNSQSSEQPEGIPR-------------Y 110

  Fly   134 QWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALV 198
            .|..:||.:::.||:.||:.:.:|||.|:.|:||...|...:|.:|:||||||.:.:.|..: |.
Zfish   111 PWNSETQGMLLGAFFFGYLFTQIPGGYLSGRFGGSLFLGGGVLGTALLTLLTPLSAQLGAKW-LF 174

  Fly   199 AVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFF 263
            |:|.|.|..||..|||:.|:.|:|.|..||..|.:...:|...|..:...::|.:.....||..|
Zfish   175 ALRALEGFGEGVTFPAMMAMWARWAPPLERARLMTFSGAGSSFGAFVALPLTGFICHSLGWPAVF 239

  Fly   264 YLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGED 328
            |..||....|.:.:.::....|...|.|..:|::||    .||.            |:.|     
Zfish   240 YSCGGAGCLWAVFWFILVSDEPRTHPRITVQEKDYI----INSL------------GQQG----- 283

  Fly   329 REHRREVEATCN--TAPWRSMLNSTPLWALVSTSMQQEFQ-QKLPQELQIALEEV---RARGTSF 387
                     |.:  :.|..|||.|.||||::...|...:. ..|...|.|.::.|   ..|..||
Zfish   284 ---------TAHGWSVPVWSMLFSMPLWAIIIPQMCSNWSYYTLLTSLPIYMDTVLHFDLRQNSF 339

  Fly   388 SELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCGSMYMLQIKMSGA 452
              |:.:     |.:..|:.|:.:|.|:|.|:|::||:.|..|::.:::.....:.::|.:..||.
Zfish   340 --LSAL-----PYLAGWLFSVGSGVLADNLLEKEILSVTAVRKIFTFIGLFLPAAFLLAVGFSGC 397

  Fly   453 ---------RIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMPYLEQLETDYK 508
                     .:.|..| |...|.:.:..:|::|.|||.|:||:...|.:|.:|.|.:....|...
Zfish   398 SGVLAVTFLTLSSAFG-GFSAAGVFINQIDIAPRYAGMLLGITNTFGTIPGVLAPIVVGYFTKNH 461

  Fly   509 LVSSVRAAMWV------IGASYI----SGDVQAFNQPERE 538
            .||..|...|:      .||.:.    :|.:|::.:.:.|
Zfish   462 SVSGWRNVFWLSAGVSAFGAIFYVIFGTGKIQSWARTDEE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 51/150 (34%)
MFS_1 135..498 CDD:284993 110/377 (29%)
si:ch1073-513e17.1XP_005159826.1 2A0114euk 32..500 CDD:129972 133/492 (27%)
MFS 112..487 CDD:119392 118/413 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.