DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and SLC17A7

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_064705.1 Gene:SLC17A7 / 57030 HGNCID:16704 Length:560 Species:Homo sapiens


Alignment Length:441 Identity:114/441 - (25%)
Similarity:192/441 - (43%) Gaps:89/441 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVR--QGGLYAL 197
            |..:|..|:..:|:.||:::.:|||.:.:::....|...||:.::.|.:|.|:|.|  .|   .:
Human   111 WDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYG---CV 172

  Fly   198 VAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVF 262
            :.||:|.|:.||..:||...:.::|.|..||..||:....|...|..:...::|:|:....|...
Human   173 IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSV 237

  Fly   263 FYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGE 327
            ||:.|...:.|:|.:.||.|.:|...|.|..|||:||                     ||.. ||
Human   238 FYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYI---------------------EDAI-GE 280

  Fly   328 DREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIA-LEEVRARGTS----F 387
            ..:....:  |..:.|||....|.|::|::..:..:.:...|....|.| .|||.....|    .
Human   281 SAKLMNPL--TKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLV 343

  Fly   388 SELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCG------------ 440
            |.|..::.||...:|        |:::|.|..::|::.|..|:||:     ||            
Human   344 SALPHLVMTIIVPIG--------GQIADFLRSRRIMSTTNVRKLMN-----CGGFGMEATLLLVV 395

  Fly   441 ----------SMYMLQIKMSGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPAL 495
                      |..:|.:..||   :::.|....:       ||::|.||..|||||.|:|.|..:
Human   396 GYSHSKGVAISFLVLAVGFSG---FAISGFNVNH-------LDIAPRYASILMGISNGVGTLSGM 450

  Fly   496 LMPYLEQLETDYK----------LVSSVRAAMWVIGASYISGDVQAFNQPE 536
            :.|.:....|.:|          :.|.|.....:....:.||:.|.:.:||
Human   451 VCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 42/146 (29%)
MFS_1 135..498 CDD:284993 104/391 (27%)
SLC17A7NP_064705.1 MFS_SLC17A6_7_8_VGluT 66..490 CDD:340940 109/428 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..560 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.