DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and CG7091

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster


Alignment Length:512 Identity:116/512 - (22%)
Similarity:199/512 - (38%) Gaps:118/512 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VRQRWVLCCFTFLAIINAYTMRLCLDCT----LNRIILECGGHRVDNVPQVLNPKALPNWRIELA 78
            ||..:.:|.|          :..||...    |..|||           :::.|:  |...:.:.
  Fly    26 VRLTYAICAF----------LATCLHAAMRNMLGMIIL-----------KMVMPR--PEDALVVP 67

  Fly    79 MALNH-TEYQLRSRLKAGKEQPDLN-QISAKGTRDREPAGEKRPGQEDSQERLSCSEQWPRQTQS 141
            ..|:. ||..:.|..:.|..:...| ||                     ||..|....|.|..:.
  Fly    68 AGLSRLTEGNVTSTGRCGSPRVVFNPQI---------------------QETQSGDLPWTRNQEL 111

  Fly   142 LVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVR---QGGLYALVAVRLL 203
            .....:|.|||:|....|.||:|...|.:...:::..||..:|.|....   :.|:..||...||
  Fly   112 TFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAVAYILLPAMAHSSFEAGVVDLVICGLL 176

  Fly   204 VGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFFYLVGG 268
            .| |..   ||:..|...|....||..|.|...||..:|..:|..|:..| :...|.:.||:|||
  Fly   177 AG-CGN---PAMYKLFVTWAHPTERTALLSFAYSGLLMGSMLVYPVASYL-SNFGWELSFYVVGG 236

  Fly   269 GAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGEDREHRR 333
            ..:::.:....:.|.|.:..|.|.:||.:|:|...|.     .|::|:.:               
  Fly   237 VGLSFGIACCFLVYDTVEQHPRISNEEVDYLRQGKSQ-----LGQQRQPV--------------- 281

  Fly   334 EVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQ-----QKLPQELQIALE-EVRARGTSFSELTT 392
                  .|.||:|:|.:.|::|.:.|.|...:.     |.:|:.::.|:| ::|..|        
  Fly   282 ------VTIPWKSLLAAPPVYAFILTHMFHTYTFLVIVQLMPRFMREAMEFDLREVG-------- 332

  Fly   393 IIETIAPSVGNWIASLTTGRLSDVLIEQQI-------------LTRTQTRRLMSWLVFL-CGSMY 443
             ..:.||.:|. |.|.....|....:|:::             :....|..|:..::.. |....
  Fly   333 -FLSAAPYLGG-ICSKVMCILGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILANCDDKI 395

  Fly   444 MLQIKMSGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMPYL 500
            ::.:..:.....:.:|...|:.::    |..:|::||.|.|::.||..|...|.|:|
  Fly   396 LVLVMFAFMMATTDMGFSGYWPTL----LYFAPSFAGLLSGLANGMAHLSGFLAPHL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 44/153 (29%)
MFS_1 135..498 CDD:284993 91/385 (24%)
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 101/438 (23%)
MFS 115..482 CDD:119392 91/379 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.