DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and CG12490

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster


Alignment Length:434 Identity:103/434 - (23%)
Similarity:170/434 - (39%) Gaps:78/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |....:|.:..:|:.||:|:...||.|.:|:|.|.|:...:..|.|.:.|||..:..||..|...
  Fly    57 WTEAEKSYIFSSFFWGYILTQFIGGYLCKRFGVKSVMFWGVFVSGVCSALTPLFIGFGGWQAYCG 121

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQ-DWPVFF 263
            :|:::|:.:|..||.:...||:|.|..||..|.:...:|.|.|......:||::.... .||...
  Fly   122 IRVVMGLAQGLVFPCIHHHLAKWSPPAERNRLGALSHTGMECGNVSAMFLSGMIAKSAIGWPGIS 186

  Fly   264 YLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGED 328
            |:..|.|.||...:.:..........:|..||..||..:.                         
  Fly   187 YVSAGLAFAWCAIWFVFAADNAVESRYITQEELHYIESSL------------------------- 226

  Fly   329 REHRREVEATCNTAPWRSMLNSTPLWALVSTSM-----QQEFQQKLPQELQIALEEVRARGTSFS 388
             :|..:...|....||.::..|.|..||..|..     ....|.::|..:...|:........||
  Fly   227 -KHNEDYHKTVIPVPWMAIWTSAPFLALTLTRCCATWGLSTLQAQIPTYMNGVLDMDMKSNAFFS 290

  Fly   389 ELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVF------LCG------- 440
            .|        |.:..||.|.....::|||:....|:.|..|:..:.|.|      |.|       
  Fly   291 AL--------PFLAMWIMSYVYLIIADVLLAGNRLSLTALRKTFNSLAFWIPCATLIGIGFLDQE 347

  Fly   441 ----SMYMLQIKM---SGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMP 498
                ::.::.|.:   |||.|.|.|.           .:|:|||:|..||||......:..::.|
  Fly   348 QKNLAIALMTISVGVNSGATIGSSLN-----------TIDLSPNHASILMGILNTAVTVVPIVTP 401

  Fly   499 YL-------EQLETDYKLVSSVRAAMWVIGASYISGDVQAFNQP 535
            .:       :....::::|..:.|.::.:|.|.......|.:||
  Fly   402 LIVGVIVHEDDNRAEWQIVFIIAAVLFFVGNSVYLYFGTAVSQP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 45/145 (31%)
MFS_1 135..498 CDD:284993 95/388 (24%)
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 103/434 (24%)
MFS 54..438 CDD:119392 100/425 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
76.960

Return to query results.
Submit another query.