DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and CG15096

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster


Alignment Length:428 Identity:113/428 - (26%)
Similarity:207/428 - (48%) Gaps:48/428 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |..:|:||::.:|:.|||::.||.|:||.:||||.::.:.:...::|.:|||...:.||...:.|
  Fly    79 WSEKTKSLLLSSFFWGYVITQVPAGQLARKYGGKVMILSGLAICSILNILTPICAKIGGWQLVCA 143

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQ-DWPVFF 263
            :|::.|:|:|..||:...:|:||.|.:||..|.:|..||.:.|..::...||::.|.. .||..|
  Fly   144 LRVVEGLCQGVVFPSTHTILSQWAPPKERATLGTCAYSGNQFGTILMLATSGVIAASPIGWPSIF 208

  Fly   264 YLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGED 328
            |:.||....|.:.:......:|..|..|.:||::.|                 ||...|...|..
  Fly   209 YISGGIGCVWSVVYFFFGAGSPQECKSISAEEKKLI-----------------EMSQADEVSGGQ 256

  Fly   329 REHRREVEATCNTAPWRSMLNSTP-LWALVSTSMQQEFQQKLPQELQIALEEVRARGTSFSELTT 392
            .:.:.::     ..||.|...|.. |..:||.|:.......|..|:...::.:..:....:.|.:
  Fly   257 EQPKEQL-----PTPWLSFFTSPAFLVLIVSHSVHNWGFWTLLTEIPSYMKNILGKDIKSNALLS 316

  Fly   393 IIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMS----W--LVFLCGSMYML--QIKM 449
            .:    |.|..:..|.....:|..|..:..::|:.:|:|.:    |  :|.|.|..|:.  |.::
  Fly   317 SL----PYVCMFAMSFVFSSISAQLNNRNCISRSTSRKLFNSIGLWIPMVTLVGLGYVNPDQSEL 377

  Fly   450 SGARIWSVLGM-GAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMPYL-------EQLETD 506
            :...:...:|| ||.|.......:|:|||:||.||||:.|:..:.:::.|.:       |.....
  Fly   378 AVVLLCFTVGMNGATYLGFNTNHIDLSPNFAGILMGITNGVANIMSIIAPLIVGFIVTNEHDPEQ 442

  Fly   507 YKLVSSVRAAMWVIGAS-YI---SGDVQAFNQPEREPQ 540
            :::|..:.|..:::|.: |:   ..:||.:|.|..:|:
  Fly   443 WRIVFFIAAGFYLVGNTLYVIFGKANVQPWNDPPAKPR 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 51/145 (35%)
MFS_1 135..498 CDD:284993 102/373 (27%)
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 112/426 (26%)
MFS 40..464 CDD:119392 108/410 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
87.970

Return to query results.
Submit another query.