DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and MFS15

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster


Alignment Length:413 Identity:113/413 - (27%)
Similarity:184/413 - (44%) Gaps:56/413 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |...|:|.::.:|:.|||::.:|||.|:..||.|::|...:|..:.|.||||.....||...:|.
  Fly    70 WNESTKSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFYGVLICSCLALLTPFCAVNGGWTVVVV 134

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQ-DWPVFF 263
            :|.:.|:|:|..||:....|::|.|.:|||.|.....||.:.|..::..|||.:.:.. .||..|
  Fly   135 LRAVQGLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVSGYIASSSLGWPSTF 199

  Fly   264 YLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGED 328
            |:.|...:.|...:..:|.|||...|.|...||.:|.         ::|:.|...|.  |.|.:.
  Fly   200 YIPGCVGIVWSFVWLYLCSSTPAQHPTITPNERRFIE---------SSGQARRPSDA--GREEQP 253

  Fly   329 REHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEF-----QQKLPQELQIAL-EEVRARGTSF 387
            |.          ..||..:..|.|...||.......:     ..::|..::..| .:::..| ..
  Fly   254 RP----------PTPWWRIFTSVPFLVLVLAHCANNWGFWTLLTEIPTFMKNVLGMDIKNNG-PL 307

  Fly   388 SELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQIL-----TRTQTRRLMSWL--VFLCGSMYML 445
            |.|......:...|..|        |||.|.::..:     :|.....|..||  :.|.|..|:.
  Fly   308 SALPYFAMILLTCVFIW--------LSDTLKQRGTVIPLGFSRKFFNTLGMWLPMLALIGLGYIT 364

  Fly   446 Q----IKMS-GARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMPYLEQL-- 503
            :    :::: |....:|....|.|....:..:|:|||||||||||:.......::|.|.:..|  
  Fly   365 EGEANVRLAIGLLTAAVATNSATYLGFHVNHIDLSPNYAGTLMGITNCAANFMSILAPLIVGLIV 429

  Fly   504 --ETD---YKLVSSVRAAMWVIG 521
              ||:   :::|....|.::.||
  Fly   430 WDETNPAQWRIVFFFTAFVYFIG 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 49/145 (34%)
MFS_1 135..498 CDD:284993 105/381 (28%)
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 113/413 (27%)
MFS 31..459 CDD:119392 113/413 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
87.970

Return to query results.
Submit another query.