DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and NaPi-T

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001260981.1 Gene:NaPi-T / 36651 FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster


Alignment Length:531 Identity:108/531 - (20%)
Similarity:189/531 - (35%) Gaps:155/531 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EVRQRWVLCCFTFLAIINAYTMRLCLDCTLNRIILECGGHRVDNVPQVLNPKALPNWRIELAMAL 81
            :|..|.||...||:..|..|.:|:.|:.|:..:|...|                       |:..
  Fly     3 QVEARTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKG-----------------------AITS 44

  Fly    82 NHTEYQLRSRLKAGKEQPDLNQISAKGTRDREPAGEKRPGQEDSQERLSCSE------------- 133
            |.|.          :...||..::                  :..||.|...             
  Fly    45 NETH----------ENSTDLAALA------------------EMNERFSLERWFLDWANIPYEKN 81

  Fly   134 --QWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYA 196
              .|..:.|..::.:|:..:....:|||.||.:||.|.|...:.........|.| .|.......
  Fly    82 GFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIP-IVSYWSYTG 145

  Fly   197 LVAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPV 261
            |:.:|:..|...|..:|::..|.|:|:|..||....|..| |..:|:.:...:.|.:|....|..
  Fly   146 LIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAYL-GSSVGVALFYPIFGYIIDWTRWEW 209

  Fly   262 FFYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEG 326
            .:|:.|.....||:.:..:.:.:|...|.|...||::|..:...|                    
  Fly   210 VYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGAS-------------------- 254

  Fly   327 EDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIALEEVRARGTSFSELT 391
                    ::.:....||:::..|.|:|                      |..|...|..:...|
  Fly   255 --------IQGSKGPTPWKAIATSRPVW----------------------LNVVAQWGGIWGLFT 289

  Fly   392 TIIETIAPS----VGNWIASLTTGRLS------------------DVLIEQQILTRTQTRRLMSW 434
              :.|.||:    :.:|... .||.||                  |.|:....::||..|:|.::
  Fly   290 --LMTHAPTYFRLIHHWNIR-ATGFLSGLPHLMRMLFAYVFSIFADYLLRTDKMSRTNVRKLATF 351

  Fly   435 LVFLCGSMYMLQIKM------SGARIWSVLGMGAYYASIKLLPL----DMSPNYAGTLMGISGGM 489
            :  .||:..::.:.:      :.|.|..|......:.::...||    |:||||||.::|:||.:
  Fly   352 I--CCGTKGLIVLALAYFGYNATAAIVLVTVATMLHGAVSSGPLASMVDLSPNYAGIVLGVSGMI 414

  Fly   490 GALPALLMPYL 500
            |.:|..:.|::
  Fly   415 GGMPGFISPFI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 38/165 (23%)
MFS_1 135..498 CDD:284993 86/394 (22%)
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 108/531 (20%)
MFS 76..460 CDD:119392 87/407 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
87.970

Return to query results.
Submit another query.