DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a9

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:381 Identity:88/381 - (23%)
Similarity:143/381 - (37%) Gaps:115/381 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQG-GLYALV 198
            |.::...:|:.:|:.||.|:.|.||.|.:|.||:.|:..:......:|:.||.....| |..|.|
  Rat    68 WNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGFITVTTPLLAHLGSGHLAFV 132

  Fly   199 AV-RLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVF 262
            .. |:|.|:.:|..|||:.:||:|.|.|.||....|.|.:|.::|..:...:..:|:....|...
  Rat   133 TFSRILTGLLQGVYFPALTSLLSQRVQESERSFTYSTVGAGSQVGTLVTGGIGSVLLDRCGWQSV 197

  Fly   263 FYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGED----- 322
            ||..||..:.|      |.|            ..:|:                  :|.:|     
  Rat   198 FYFSGGLTLLW------VYY------------VYKYL------------------LDEKDLVLAL 226

  Fly   323 GYEGEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIALEEVRARGTSF 387
            |...:.....|.     :..|||.:.....:||::.:.:                    :...||
  Rat   227 GVLAQGLPVTRP-----SKVPWRQLFRKASVWAVICSQL--------------------SSACSF 266

  Fly   388 ----SELTTIIETIAPSVGNWI-----------ASLTTGRLSDVLIEQ--QILTRTQTRRLMSWL 435
                |.|.|..:...|....|:           |||.:|.:||.||.|  :::|   .|:.|   
  Rat   267 FILLSWLPTFFKETFPHSKGWVFNVVPWLLAIPASLFSGFISDRLISQGYRVIT---VRKFM--- 325

  Fly   436 VFLCGSMYMLQIKMSGARIWSVLGM----GAYY---------ASIKLLPLDMSPNY 478
                      |...:|...|||...    |:::         .|:..|| |:.|.:
  Rat   326 ----------QPCPAGHGPWSVKHFCPVSGSHHKLPQVYDLCVSVHWLP-DLQPQW 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 46/146 (32%)
MFS_1 135..498 CDD:284993 88/381 (23%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 77/334 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.