DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and VGlut

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001245848.1 Gene:VGlut / 33427 FlyBaseID:FBgn0031424 Length:632 Species:Drosophila melanogaster


Alignment Length:442 Identity:115/442 - (26%)
Similarity:194/442 - (43%) Gaps:83/442 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |....:|.|..:|:.||:::.:|||.:|.::....:...:|::||.|.|..|.|:.....:.::.
  Fly   133 WTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVIC 197

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFFY 264
            ||:|.|:.||..:||...:...|.|..||..||:...||...|:.:...:||||.....:...||
  Fly   198 VRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFY 262

  Fly   265 LVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGEDR 329
            ..|...:.|::.:..:|:..|...|.|...|.:||                |:..||..:     
  Fly   263 AYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYI----------------EKSLGESAH----- 306

  Fly   330 EHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQE--------FQQK-LPQELQIALEEVRARGT 385
                ....:..|.|||.|:.|.|::|::..:..:.        ||.. |..:....:||....| 
  Fly   307 ----PTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVG- 366

  Fly   386 SFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRL-------MSWLVFL----- 438
            |...|  |:.||.|         ..|.|:|.|.:..||:.|..|:|       |..|.||     
  Fly   367 SLPHL--IMTTIVP---------FGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHS 420

  Fly   439 ---CGSMYMLQ--IKMSGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMP 498
               .|:|:.|.  :..||   :::.|....:       ||::|.||..|||:|.|:|.|..:::|
  Fly   421 STATGAMFALTCGVAFSG---FAISGYNVNH-------LDIAPRYASILMGLSNGIGTLAGIIVP 475

  Fly   499 Y-----LEQLETD-YKLVSSVRAAMWVIGAS----YISGDVQAFNQPEREPQ 540
            |     ::...|. :..|.::.|.:.::|.:    :.||::|.:.:|..|.|
  Fly   476 YALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQ 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 42/144 (29%)
MFS_1 135..498 CDD:284993 103/388 (27%)
VGlutNP_001245848.1 MFS 98..512 CDD:119392 109/425 (26%)
MFS_1 101..475 CDD:284993 103/388 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.