DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a4

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_795990.2 Gene:Slc17a4 / 319848 MGIID:2442850 Length:492 Species:Mus musculus


Alignment Length:451 Identity:117/451 - (25%)
Similarity:200/451 - (44%) Gaps:82/451 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NQISAKGTRDREPAGEKRPGQEDSQERLSCSEQWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYG 166
            :|::|  :.:|.|...:....|..||..:....|..:.|.:::.:...|..::.:|.|.:|..:|
Mouse    69 SQLNA--STERPPTNSQDVWNETLQESKAPVYDWTPEIQGILLSSLSYGSFIAPIPTGYVAGVFG 131

  Fly   167 GKWVLSAAILTSAVLTLLTPTAVRQGGLYALVAVRLLVGICEGPCFPAVCALLAQWVPEQERGML 231
            .|:|:...:|.|:||||..|.|. ..|:..|:.:|::.|:.:........:|.|:|.|.|||..|
Mouse   132 AKYVVGLGLLISSVLTLFIPLAA-DAGVALLIVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQL 195

  Fly   232 ASCVLSGGEIGITMVQLVSGLLIAEQDWPVFFYLVGG-GAVAWFLGFTLVCYSTPDHCPFIQSEE 295
            .:...||..:|..:|.:..||:.....||..||:.|| |.....|.|.|| |..|.:.|||.:.|
Mouse   196 ITIAASGSMLGTFLVLIAGGLICQALGWPYIFYIFGGIGCACCLLWFPLV-YDDPQNHPFISTGE 259

  Fly   296 REYIRCNTSNSFLLTTGREREEMDGEDGYEGEDREHRREVEATCN---TAPWRSMLNSTPLWALV 357
            |.||.|:.:.                     ||          |:   :.|.::|:.|.||||:|
Mouse   260 RRYITCSLAQ---------------------ED----------CSLGWSLPIKAMVKSLPLWAIV 293

  Fly   358 ----------STSMQQEFQQKLPQELQIALE-EVRARGTSFSELTTIIETIAPSVGNWIASLTTG 411
                      ||.|..     .|..:...|: .:|..|         |.:..|.:...:..:..|
Mouse   294 VSYFCEYWLLSTVMAY-----TPTYISSVLQANLRDSG---------ILSALPFMFGCVCIILGG 344

  Fly   412 RLSDVLIEQQILTRTQTRRLMSWLVFLCGSMYMLQ---IKMSGARIWSVLGMGAYYASI----KL 469
            .|:|.|:.::||.....|:|.:.:..|..|..:|.   ::.|.:...:.|.:.:.:||:    .|
Mouse   345 LLADFLLSRKILRLVTIRKLFTAVGVLASSGILLPLPWVRSSRSTTMAFLVLSSVFASLCDSGAL 409

  Fly   470 LP-LDMSPNYAGTLMG-------ISGGMGALPALLMPYLEQ-LETDYKLVSSVRAAMWVIG 521
            :. ||::|.|||.|.|       ::||:.  |.:...::.| .|..::.|..:.||:.|:|
Mouse   410 INFLDIAPRYAGFLKGLLQVFSYLAGGIA--PTVAGFFISQDSEFGWRNVFFLAAAIDVVG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 44/151 (29%)
MFS_1 135..498 CDD:284993 103/392 (26%)
Slc17a4NP_795990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
2A0114euk 27..486 CDD:129972 117/451 (26%)
MFS 98..475 CDD:119392 110/420 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.