DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and ZK54.3

DIOPT Version :10

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001379785.1 Gene:ZK54.3 / 266895 WormBaseID:WBGene00022648 Length:89 Species:Caenorhabditis elegans


Alignment Length:54 Identity:12/54 - (22%)
Similarity:21/54 - (38%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RPGQEDSQERLSCSEQWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLS 172
            ||....:.|.:..|::|.|:....|:..|...::            ||.:..||
 Worm     9 RPLSNGTTEAIDDSKRWKRRHLVAVLAMFGFAFI------------YGTQITLS 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 134..522 CDD:475125 8/39 (21%)
ZK54.3NP_001379785.1 None

Return to query results.
Submit another query.