DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a3

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_006254003.1 Gene:Slc17a3 / 266730 RGDID:628815 Length:538 Species:Rattus norvegicus


Alignment Length:412 Identity:110/412 - (26%)
Similarity:167/412 - (40%) Gaps:92/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QEDSQERLSCSE---QWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTL 183
            |.::.:.||...   .|..|||.::..:...|.:|...|||.||.:.|.|.|:..|:|.|::|||
  Rat   131 QHEASKHLSIKAPVYNWSPQTQGIIFSSVQYGMMLMQGPGGYLAGKLGTKKVVGIALLGSSLLTL 195

  Fly   184 LTPTAVRQGGLYALVAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQL 248
            ..|.|... ||..|:|.|.:.|:.:|..:....||..:|.|..||..|.|..:||..:||..|.|
  Rat   196 CIPLAANL-GLAFLLATRAVQGLTQGAGYGGQFALWQKWAPPNERSRLCSIAMSGMILGIFAVLL 259

  Fly   249 VSGLLIAEQDWPVFFYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGR 313
            |.|::.....||..||:.|...|...|.:.::.|..|...|:|.|.|:|||..:....|      
  Rat   260 VGGIISEALGWPFVFYIFGSIGVVCCLLWLILVYDDPVSHPWISSPEKEYILSSLDQQF------ 318

  Fly   314 EREEMDGEDGYEGEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQI--- 375
            ..||                      ...|.::||.|.|||::...||..::   |...|.|   
  Rat   319 NSEE----------------------QPLPIKAMLKSLPLWSMCLCSMTHQW---LVNTLIIYTP 358

  Fly   376 ----ALEEVRARGTSFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQ-----------ILTR 425
                ::.:|..|....  |:::     |....|:..:..|.|:|.|:.:.           ||..
  Rat   359 TYISSVFKVNIRDNGL--LSSL-----PFFVAWVIGILGGLLADFLLSKNFRLITVRKIITILGN 416

  Fly   426 TQTRRLM--------------SWLVFLCGSMYMLQIKMSGARIWSVLGMGAYYASIKLLPLDMSP 476
            |....|:              ::|...||...:.|             .|.|     :..||::|
  Rat   417 TPPAALVVALPYVQSSYIATTTFLTLSCGLSPLCQ-------------SGVY-----INALDIAP 463

  Fly   477 NYAGTLMGISGGMGALPALLMP 498
            .||..|||.|.|:....|:::|
  Rat   464 RYASLLMGTSRGLAHSSAVMVP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 54/153 (35%)
MFS_1 135..498 CDD:284993 106/394 (27%)
Slc17a3XP_006254003.1 2A0114euk 71..537 CDD:129972 110/412 (27%)
MFS 145..522 CDD:119392 107/398 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.