DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and SPCC417.10

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_588287.1 Gene:SPCC417.10 / 2539419 PomBaseID:SPCC417.10 Length:508 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:49/195 - (25%)
Similarity:78/195 - (40%) Gaps:43/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 AFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVAVRLLVGICEGP 210
            |||.||::...|...|.:|:.....|...::....|..:|..|...|    .:|:|:|:|:.|..
pombe   108 AFYLGYLVFEFPASLLLQRFPLSKTLCVFLVIWGFLLCMTSVANYPG----FIALRVLLGMMESA 168

  Fly   211 CFPAVCALLAQWVPEQERGM--------------LASCVLSGGEIGITMVQLVSGLLIAEQDWPV 261
            ..|....|.|||....|:.:              |.||:..|         |.....:..:.|.:
pombe   169 ASPGFILLTAQWYKRSEQQLRTSVWVAFNGLGQILGSCMAYG---------LAKRTSLPMRGWKL 224

  Fly   262 FFYLVGGGAVAWFLGFTLVCYSTPDHCP----FIQSEEREYI----RCNT----SNSFLLTTGRE 314
            .|.:.  |.:|.||||.::.. .||: |    |:..|:|:.:    |.|.    :|.|.|...:|
pombe   225 IFIIC--GVLAIFLGFVILAV-VPDN-PFKAWFLTEEDRKLVVKRLRANKQGVGNNHFKLYQFKE 285

  Fly   315  314
            pombe   286  285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 37/147 (25%)
MFS_1 135..498 CDD:284993 49/195 (25%)
SPCC417.10NP_588287.1 MFS 66..436 CDD:119392 49/195 (25%)
2A0114 71..468 CDD:273326 49/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.