DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a2

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_006516709.1 Gene:Slc17a2 / 218103 MGIID:2443098 Length:480 Species:Mus musculus


Alignment Length:491 Identity:119/491 - (24%)
Similarity:200/491 - (40%) Gaps:112/491 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RIELAMAL----NHTEYQLRSRLKAGKEQPDLNQISAKGTRDREPAGEKRPGQEDSQERLSCSEQ 134
            |:.|::|:    |.|::|  ....|..|.|.::.:|           .:..|.:|...| :...|
Mouse    35 RVSLSIAIIAMVNSTQHQ--DPANASTEGPVMDLLS-----------NQSRGIKDFSTR-AAVYQ 85

  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |..:||.::..:...|.:|:.:|.|.||..:|.|.:|.|.:|.|::|||.||.|. ..|:..::.
Mouse    86 WSTETQGIIFSSISYGIILTLIPSGYLAGIFGAKQILGAGLLISSLLTLFTPLAA-DFGVILVIV 149

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQ--------LVSGLLIAE 256
            :|.:.|:.:|..:.....:.|:|.|..||..|.|...||.::|...|.        .::|..:| 
Mouse   150 IRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTSIAGSGEDVGSVWVLHHPLCGRINLTGTGLA- 213

  Fly   257 QDWPVFFYLVG--GGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMD 319
                  |||:.  .|.|...|.||:: |..|.|.|.|...|:|:|..:.:.              
Mouse   214 ------FYLLHLCIGCVCCVLWFTVI-YDDPMHHPCISVREKEHITSSVAQ-------------- 257

  Fly   320 GEDGYEGEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQ-----QKLPQELQIALE- 378
                   :....||.|       |.::|:...||||:........:.     ..||..:...|. 
Mouse   258 -------QSSSPRRSV-------PIKAMVRCLPLWAIFMGFFSHFWLCTIIITYLPTYISTVLHV 308

  Fly   379 EVRARGTSFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCGSMY 443
            .:|..|. .|.|..|..:....:|        |:::|.|:.:.:|:....|:|.|.|..|..|:.
Mouse   309 NIRDSGV-LSSLPFIAASSCTILG--------GQMADFLLSRNLLSLITVRKLFSSLGLLLPSLC 364

  Fly   444 MLQIKMSGARIWSVLGMGAYYASIKLL-----------------PLDMSPNYAGTLMGISGGMGA 491
            .:.:...         ..:|.|:|.||                 .||::|.||..|||||.|.|.
Mouse   365 AVALPFV---------TSSYIATIVLLILIPGTSNLCDSGFIINTLDVAPRYASFLMGISRGFGL 420

  Fly   492 LPALLMP----YL--EQLETDYKLVSSVRAAMWVIG 521
            ...::..    :|  :..|:.::.|..:.||:.:.|
Mouse   421 TAGIISSTTTGFLISQDSESGWRNVFFLSAAVNMFG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 47/160 (29%)
MFS_1 135..498 CDD:284993 99/395 (25%)
Slc17a2XP_006516709.1 MFS_SLC17 21..464 CDD:340876 119/491 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.