DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and slc-17.9

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001379067.1 Gene:slc-17.9 / 181189 WormBaseID:WBGene00011643 Length:516 Species:Caenorhabditis elegans


Alignment Length:449 Identity:95/449 - (21%)
Similarity:172/449 - (38%) Gaps:102/449 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IELAMALNHTEYQLRSRLKAGKEQPDLNQISAKGTRDREPAGEKRPGQEDSQERLSCSE----QW 135
            :.||:..::....:...:|    :||.|...              |..|...|.:.|:.    .|
 Worm    33 VALAIGTSNISQSMVCMVK----KPDTNYTC--------------PLAEPEVEAIPCNHPKQFAW 79

  Fly   136 PRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAA----ILTSAVLTLLTPTAVRQGGLYA 196
            ....|.|:......|.:...:.|.: |:|..|||.:.||    |:::|||      .:..|..:|
 Worm    80 SSIQQGLIYSGQNFGSLFMVITGWQ-ADRLNGKWTIVAAMAFIIVSNAVL------PISAGASFA 137

  Fly   197 LV-AVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQ--- 257
            || .:|:|.|..:....||..:|:.:|.|.:||......|.||.:||..::..:.|.|....   
 Worm   138 LVFFLRVLTGFGDALLSPASSSLITRWFPPKERPSALGIVTSGRQIGTLIILPIGGWLCGSDGSK 202

  Fly   258 ---DWPVFFYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMD 319
               .||..|||....|.|..:.:.:.....|.....|...|..||            .|:.||  
 Worm   203 FLGGWPAIFYLSSVVAAAVLVIWVVFSADKPSKHLCISHNEEAYI------------NRKIEE-- 253

  Fly   320 GEDGYEGEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQ-----QKLPQELQIALEE 379
                 |...:.:.|:     || ||:::..|..:|..|:..:..||.     |.||:        
 Worm   254 -----ENIGKRNNRK-----NT-PWKAIFTSKQVWVAVAALVCHEFPLVIMLQFLPK-------- 299

  Fly   380 VRARGTSFSELTTIIETI------APSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFL 438
                  .||::..:..|:      .|....:::...:..|:..|.....|.:||:.::.:::..|
 Worm   300 ------FFSDVLGLSNTVNGLVSALPMAILFLSKCLSASLASYLTANGYLRKTQSCKIFNFIASL 358

  Fly   439 ----CGSMYMLQIKMSGARIWSVLGM-------GAYYASIKLLPLDMSPNYAGTLMGIS 486
                |.:...|...:..| ||:::.:       |.:...:....:.::|.::|.:.|::
 Worm   359 GLGICIAATPLMSNLQHA-IWAIIILCLANAFAGLHTPGVLTAIVQLAPAFSGIITGLA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 45/165 (27%)
MFS_1 135..498 CDD:284993 85/385 (22%)
slc-17.9NP_001379067.1 2A0114euk 5..474 CDD:129972 95/449 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.