DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and C01B4.7

DIOPT Version :10

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_503683.1 Gene:C01B4.7 / 178722 WormBaseID:WBGene00015271 Length:475 Species:Caenorhabditis elegans


Alignment Length:153 Identity:34/153 - (22%)
Similarity:60/153 - (39%) Gaps:6/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQT--QSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYAL 197
            |...|  :|::..|...|.:::.:|...:....|.:..||...|.|.:.|..||.||.. ..|.:
 Worm    83 WIEGTTEKSILFSATAIGALVALIPSVPILNSLGVRLTLSFCGLCSTLGTFFTPLAVTY-SFYLV 146

  Fly   198 VAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLI-AEQDWPV 261
            |..|:|.||........:..:.:.|.|:.|.....:.:....:....:...:||:|. :...|..
 Worm   147 VFCRVLQGIGISVILTVLGVIPSYWSPKTEYSTYLAILSCAWQFSNVIFMPISGILCDSSFGWRS 211

  Fly   262 FFYLVGGGAVAWFLGFTLVCYST 284
            .:|:.  |....|..|....:.|
 Worm   212 IYYVF--GVATGFFYFVFFMFYT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 134..522 CDD:475125 34/153 (22%)
C01B4.7NP_503683.1 MFS 89..>332 CDD:475125 32/147 (22%)

Return to query results.
Submit another query.