DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Y19D10A.4

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_503657.2 Gene:Y19D10A.4 / 178718 WormBaseID:WBGene00021219 Length:475 Species:Caenorhabditis elegans


Alignment Length:153 Identity:34/153 - (22%)
Similarity:60/153 - (39%) Gaps:6/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQT--QSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYAL 197
            |...|  :|::..|...|.:::.:|...:....|.:..||...|.|.:.|..||.||.. ..|.:
 Worm    83 WIEGTTEKSILFSATAIGALVALIPSVPILNSLGVRLTLSFCGLCSTLGTFFTPLAVTY-SFYLV 146

  Fly   198 VAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLI-AEQDWPV 261
            |..|:|.||........:..:.:.|.|:.|.....:.:....:....:...:||:|. :...|..
 Worm   147 VFCRVLQGIGISVILTVLGVIPSYWSPKTEYSTYLAILSCAWQFSNVIFMPISGILCDSSFGWRS 211

  Fly   262 FFYLVGGGAVAWFLGFTLVCYST 284
            .:|:.  |....|..|....:.|
 Worm   212 IYYVF--GVATGFFYFVFFMFYT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 33/147 (22%)
MFS_1 135..498 CDD:284993 34/153 (22%)
Y19D10A.4NP_503657.2 MFS 89..>332 CDD:391944 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.