DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Y4C6B.3

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001293768.1 Gene:Y4C6B.3 / 177313 WormBaseID:WBGene00021157 Length:459 Species:Caenorhabditis elegans


Alignment Length:260 Identity:57/260 - (21%)
Similarity:101/260 - (38%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVAVRLLVGIC 207
            ::.|...|.::...|...|..:.|.:....:|.|.||:.|..||.|..| .::.|||:|.|.|:.
 Worm    66 ILWAVSFGTIVGIFPINMLYVQCGARLAFFSAGLLSAMTTAFTPWAASQ-SMWFLVALRFLQGVA 129

  Fly   208 EGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLI-AEQDWPVFFYLVGGGAV 271
            ....|.|:..::::|.|..|..:..:.:.|...|...:...|||::. :...|...|||.....:
 Worm   130 YSADFAAIGIIISKWAPLDETAVFIATLTSFTAISSIITNGVSGVICESHLGWRWSFYLHAAACL 194

  Fly   272 AWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGEDREHRREVE 336
            ..||.:.||..:.|.....:.::|...|:.|.|::.:      ::.|.                 
 Worm   195 IVFLTWGLVYKNDPSLHKSVSAKELGKIQKNKSDAHM------KDSMQ----------------- 236

  Fly   337 ATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIALEEVRARGTSFSELTT--IIETIAP 399
                 .|:|.:..|                   |..:.:.|       .:|:||:|  :|.|.||
 Worm   237 -----IPYRKIFTS-------------------PVVITVWL-------CAFTELSTLILIATYAP 270

  Fly   400  399
             Worm   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 36/137 (26%)
MFS_1 135..498 CDD:284993 57/260 (22%)
Y4C6B.3NP_001293768.1 MFS 15..433 CDD:391944 57/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.