DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and eat-4

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_499023.3 Gene:eat-4 / 176291 WormBaseID:WBGene00001135 Length:576 Species:Caenorhabditis elegans


Alignment Length:428 Identity:101/428 - (23%)
Similarity:183/428 - (42%) Gaps:57/428 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALVA 199
            |.....|::..:::.||:::.:|.|.||.::....:....|...|.|.:|.|...:....|.:..
 Worm   115 WTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAF 179

  Fly   200 VRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFFY 264
            :::..|:.:|.|:||:..:...|.|..||..||:...:|...|..:...:|..|::...|...||
 Worm   180 IQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFY 244

  Fly   265 LVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGEDR 329
            |.|...|.|.:.:..|.:..|...|.|..||:.:|                |:..|         
 Worm   245 LYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFI----------------EDAIG--------- 284

  Fly   330 EHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIA-LEEVRARGTSFSELTTI 393
             |......|..:.||::::.|.|:||::..:..:.:...|..:.|:. ::|......:.|.|...
 Worm   285 -HVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAA 348

  Fly   394 IETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCG-----SMYMLQIKMSGAR 453
            |    |.:......|..|:|:|.|...:||:.|..|:     :|.||     :.:||.:..:.:.
 Worm   349 I----PHLVMGCVVLMGGQLADYLRSNKILSTTAVRK-----IFNCGGFGGEAAFMLIVAYTTSD 404

  Fly   454 IWSVL------GMGAYYAS-IKLLPLDMSPNYAGTLMGISGGMGALPALLMPYLEQLETDYK--- 508
            ..:::      ||..:..| ..:..||::|.||..|||.|.|:|.|..|..|::.:..|.:.   
 Worm   405 TTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSKHG 469

  Fly   509 ------LVSSVRAAMWVIGASYISGDVQAFNQPEREPQ 540
                  |.|.:........|.|.||::|.:.:|:.|.:
 Worm   470 WTSVFLLASLIHFTGVTFYAVYASGELQEWAEPKEEEE 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 36/144 (25%)
MFS_1 135..498 CDD:284993 90/375 (24%)
eat-4NP_499023.3 2A0114euk 66..497 CDD:129972 98/416 (24%)
MFS 110..492 CDD:119392 95/411 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.