DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and vnut-1

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_497007.1 Gene:vnut-1 / 175106 WormBaseID:WBGene00010758 Length:445 Species:Caenorhabditis elegans


Alignment Length:435 Identity:95/435 - (21%)
Similarity:169/435 - (38%) Gaps:104/435 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAV-----RQGGL 194
            |.:.....|:..|:.||.|:.|..||:|::||.:.:|..:.|...:||..||...     ....|
 Worm    55 WNKTDSGTVLSCFFWGYALTQVFAGRIADKYGAEKILPYSSLAWTMLTFFTPHLFDFAYWTNYPL 119

  Fly   195 YALVAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDW 259
            ..|:|||:|.|:|:....|::.:::::.:...::|.:...||:|...|..:...:..:||....|
 Worm   120 VVLLAVRILTGVCQAFHIPSLASIVSKHLAAADKGRVFGIVLAGSHWGTVLAGAIGSILIEWIGW 184

  Fly   260 PVFFYLVGGGAVAWFLGFTLVC--------YSTPDHCPFIQSEEREYIRCNTSNSFLLTTGRERE 316
            ...|..||..::.|...|..|.        .|:|     :..||           .||       
 Worm   185 RALFQFVGIISLIWCWVFRWVLDRAKGPGGRSSP-----LPDEE-----------VLL------- 226

  Fly   317 EMDGEDGYEGEDREH---RREVEAT--CNTAPWRSMLNSTPLWA-------------LVSTSMQQ 363
                       |::|   ...:.||  |.:.||.::......||             ::...:..
 Worm   227 -----------DKKHDTIESHLAATSPCPSVPWGTLFRHPAFWAAAVAQYTGGNSYSILFNWLPS 280

  Fly   364 EFQQKLPQELQIALEEVRARGTSFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQI---LTR 425
            .|.:..|          .|:|        .:..:.||    :|.:.|..::.|:..:.:   .|.
 Worm   281 YFHETFP----------TAKG--------FVYNVVPS----LAIVVTSLVAPVMASRALSEGKTV 323

  Fly   426 TQTRRLMSWLVFLCGSMYMLQIKMSGARIW--------SVLGMGAYYASIKLLPLDMSPNYAGTL 482
            |.||:||.. ..|.|..:.|.:....:..|        ::...|.::..:.:.|.|.:||:||::
 Worm   324 TYTRKLMEG-ASLLGIAFCLMLVPMTSSFWISLIIFTMAMAARGLHHGGVSVNPHDFAPNHAGSV 387

  Fly   483 MGISGGMGALPALLMPY-----LEQLETDYKLVSSVRAAMWVIGA 522
            .|:....||:...:..|     ||....::..|..|.||..|:||
 Worm   388 FGVFNACGAITGFVGVYIAGHILEATNNNWSYVFVVTAAQCVVGA 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 40/149 (27%)
MFS_1 135..498 CDD:284993 85/404 (21%)
vnut-1NP_497007.1 MFS_SLC17A9_like 25..439 CDD:340938 95/435 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.