DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and T05H10.3

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_495688.1 Gene:T05H10.3 / 174292 WormBaseID:WBGene00011508 Length:158 Species:Caenorhabditis elegans


Alignment Length:112 Identity:30/112 - (26%)
Similarity:43/112 - (38%) Gaps:24/112 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 LVCYSTPDHCPFIQSEEREY--IRCNTSNS-FLLTTGREREEMDGEDGYEGEDR--EHRREVEAT 338
            |.|:. .||    ..|||||  |.|..|:: |:....:..........|:.|.|  ||       
 Worm    60 LGCWQ-EDH----DGEEREYCDIVCPKSHTVFISYIDQGHRACFNFITYQVEKRNDEH------- 112

  Fly   339 CNTAPWRS--MLNSTPLWALVSTSMQQEFQQKLPQELQIALEEVRAR 383
               ..|||  .||||..:. :.......|:.:...:.:| ...:|||
 Worm   113 ---VLWRSGKCLNSTVNYR-IGCKFDDPFETQFKSDNEI-FAHLRAR 154

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity