DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and Slc17a7

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_038966881.1 Gene:Slc17a7 / 116638 RGDID:620101 Length:585 Species:Rattus norvegicus


Alignment Length:564 Identity:134/564 - (23%)
Similarity:219/564 - (38%) Gaps:145/564 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QRWVLCCFTFLAIINAYTMRLCLDCTLNRIILEC--------GGHRVDNVPQVLNPKALPNWRIE 76
            :|:::...:.|....::.:|    |.|...|:..        |||.|...|              
  Rat    61 RRYIIAIMSGLGFCISFGIR----CNLGVAIVSMVNNSTTHRGGHVVVQTP-------------- 107

  Fly    77 LAMALNHTEYQLRSRLKAGKEQPDLNQISAKGTRDREPAGEKRPGQEDSQERLSCSEQWPRQTQS 141
                       .||..|.....|.:..|....|       ||            ....|..:|..
  Rat   108 -----------YRSVHKQEAVTPTVGDIQGGDT-------EK------------AQFNWDPETVG 142

  Fly   142 LVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVR--QGGLYALVAVRLLV 204
            |:..:|:.||:::.:|||.:.:::....|...||:.::.|.:|.|:|.|  .|   .::.||:|.
  Rat   143 LIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYG---CVIFVRILQ 204

  Fly   205 GICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFFYLVGGG 269
            |:.||..:||...:.::|.|..||..||:....|...|..:...::|:|:....|...||:.|..
  Rat   205 GLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSF 269

  Fly   270 AVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGEDREHRRE 334
            .:.|:|.:.||.|.:|...|.|..|||:||                     ||.. ||..:....
  Rat   270 GIFWYLFWLLVSYESPALHPSISEEERKYI---------------------EDAI-GESAKLMNP 312

  Fly   335 VEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIA-LEEVRARGTS----FSELTTII 394
            |  |....|||....|.|::|::..:..:.:...|....|.| .|||.....|    .|.|..::
  Rat   313 V--TKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLV 375

  Fly   395 ETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCG------------------- 440
            .||...:|        |:::|.|..:.|::.|..|:||:     ||                   
  Rat   376 MTIIVPIG--------GQIADFLRSRHIMSTTNVRKLMN-----CGGFGMEATLLLVVGYSHSKG 427

  Fly   441 ---SMYMLQIKMSGARIWSVLGMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPALLMPYLEQ 502
               |..:|.:..||   :::.|....:       ||::|.||..|||||.|:|.|..::.|.:..
  Rat   428 VAISFLVLAVGFSG---FAISGFNVNH-------LDIAPRYASILMGISNGVGTLSGMVCPIIVG 482

  Fly   503 LETDYK----------LVSSVRAAMWVIGASYISGDVQAFNQPE 536
            ..|.:|          :.|.|.....:....:.||:.|.:.:||
  Rat   483 AMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 42/152 (28%)
MFS_1 135..498 CDD:284993 105/391 (27%)
Slc17a7XP_038966881.1 MFS_SLC17A6_7_8_VGluT 66..515 CDD:340940 128/546 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.