DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and SLC17A3

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001091956.1 Gene:SLC17A3 / 10786 HGNCID:10931 Length:498 Species:Homo sapiens


Alignment Length:480 Identity:111/480 - (23%)
Similarity:192/480 - (40%) Gaps:98/480 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VPQVLNPKALPNW---RIELAMALNHTEY-----------QLRSRLKAGKEQPDLNQ------IS 105
            |.:.|.|:.:|:.   |..:|:.|:...:           .:.:.:.:...|..||.      :.
Human    22 VDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMNITMVAMVNSTSPQSQLNDSSEVLPVD 86

  Fly   106 AKGTRDREPAG--EKRPGQEDSQERLSCSEQWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGK 168
            :.|...:.|..  .|.|..:           |..|.|.::..|...|.:|:..|.|.||.|.|.|
Human    87 SFGGLSKAPKSLPAKAPVYD-----------WSPQIQGIIFGAVGYGGILTMAPSGYLAGRVGTK 140

  Fly   169 WVLSAAILTSAVLTLLTPTAVRQGGLYALVAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLAS 233
            .|:..::..::.|||..|.|. ..|:..|:..|::.|:.:........|:..:|.|.|||..|.|
Human   141 RVVGISLFATSFLTLCIPLAT-DFGIVLLIVTRIVQGLSQSSILGGQFAIWEKWGPPQERSRLCS 204

  Fly   234 CVLSGGEIGITMVQLVSGLLIAEQDWPVFFYLVGG-GAVAWFLGFTLVCYSTPDHCPFIQSEERE 297
            ..|||..:|.....|:.|.:.....||..||:.|| |.|...|.| :|.|..|...|:|.:.|:|
Human   205 IALSGMLLGCFTAILIGGFISETLGWPFVFYIFGGVGCVCCLLWF-VVIYDDPVSYPWISTSEKE 268

  Fly   298 YIRCNTSNSFLLTTGREREEMDGEDGYEGEDREHRREVEATCNTAPWRSMLNSTPLWA------- 355
            ||..:.                            :::|.::....|.::||.|.|:|:       
Human   269 YIISSL----------------------------KQQVGSSKQPLPIKAMLRSLPIWSICLGCFS 305

  Fly   356 ---LVSTSMQQEFQQKLPQELQIALE-EVRARGTSFSELTTIIETIAPSVGNWIASLTTGRLSDV 416
               ||||.:..     :|..:..... .:|..|         :.:..|.:..|:..:..|.|:|.
Human   306 HQWLVSTMVVY-----IPTYISSVYHVNIRDNG---------LLSALPFIVAWVIGMVGGYLADF 356

  Fly   417 LIEQQILTRTQTRRLMSWLVFLCGSMYMLQIKM--SG-----ARIWSVLGMGAYYAS-IKLLPLD 473
            |:.::....| .|::.:.|..|..|..::.:..  ||     |.:....|:.....| |.:..||
Human   357 LLTKKFRLIT-VRKIATILGSLPSSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLD 420

  Fly   474 MSPNYAGTLMGISGGMGALPALLMP 498
            ::|.|:..|||.|.|..::..:::|
Human   421 IAPRYSSFLMGASRGFSSIAPVIVP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 47/151 (31%)
MFS_1 135..498 CDD:284993 96/382 (25%)
SLC17A3NP_001091956.1 2A0114euk 23..497 CDD:129972 110/479 (23%)
MFS 98..481 CDD:119392 99/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.