DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18788 and SLC17A2

DIOPT Version :9

Sequence 1:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:442 Identity:110/442 - (24%)
Similarity:181/442 - (40%) Gaps:100/442 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALV 198
            ||..:||.::..:...|.:|:.:|.|.||..:|.|.:|.|.:|.|::|||.||.|. ..|:..::
Human    85 QWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTPLAA-DFGVILVI 148

  Fly   199 AVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLIAEQDWPVFF 263
            .||.:.|:.:|..:.....:.|:|.|..||..|.:...||...|..::..|.||:.....||..|
Human   149 MVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGLISQALSWPFIF 213

  Fly   264 YLVGG-GAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGE 327
            |:.|. |.|...|.||:: |..|.|.|.|...|:|:|         |::..::....|       
Human   214 YIFGSTGCVCCLLWFTVI-YDDPMHHPCISVREKEHI---------LSSLAQQPSSPG------- 261

  Fly   328 DREHRREVEATCNTAPWRSMLNSTPLWA-------------LVSTSMQQEFQQKLPQELQIALE- 378
                        ...|.::|:...||||             ::.|        .||..:...|. 
Human   262 ------------RAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILT--------YLPTYISTLLHV 306

  Fly   379 EVRARGTSFSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVFLCGSMY 443
            .:|..|...|         .|.:.....::..|:|:|.|:.:.:|.....|:|.|.|..|..|:.
Human   307 NIRDSGVLSS---------LPFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPSIC 362

  Fly   444 MLQIKMSGARIWSVLGMGAYYASIKLL-----------------PLDMSPNYAGTLMGISGGMGA 491
            .:.:....:         :|..:|.||                 .||::|.||..|||||.|.|.
Human   363 AVALPFVAS---------SYVITIILLILIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGL 418

  Fly   492 LPALLMP----YL--EQLETDYKLVSSVRAAMWVIG-ASYISGDVQAFNQPE 536
            :..::..    :|  :..|:.::.|..:.||:.:.| ..|::     |.|.|
Human   419 IAGIISSTATGFLISQDFESGWRNVFFLSAAVNMFGLVFYLT-----FGQAE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18788NP_652665.3 MFS 129..>280 CDD:119392 49/146 (34%)
MFS_1 135..498 CDD:284993 99/394 (25%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 110/442 (25%)
MFS 81..461 CDD:119392 107/436 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.