DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr65Aw

DIOPT Version :9

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:99 Identity:34/99 - (34%)
Similarity:61/99 - (61%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIVFVALFAVALAAPAAEEPTIVRSESD-VGPESFKYDWETSDGQAAQAVGQLNDIGTENEAIS 66
            |.::.|:.  .|.::.|.:...|:|.::: :..:.:.:.:|||||.:.:....|.:.||..|||:
  Fly     8 FGLILVSF--CACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIA 70

  Fly    67 VSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP 100
            :.||..::..||..|::||:||:||||.:|.|||
  Fly    71 IQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 21/54 (39%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.