DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:96 Identity:34/96 - (35%)
Similarity:39/96 - (40%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAAPAAEEPTIVRSESDVGPE-SFKY---DWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIA 75
            ||||.|.....|....|..|: ||.|   |..|.|.: .|....:|.:        |.|||....
  Fly    71 LAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSK-QQEETLVNGV--------VHGSYSLAE 126

  Fly    76 DDGQTYQVNYIADK-NGFQPEGAHLPVAPVA 105
            .||...:|.|.||| |||........||.||
  Fly   127 PDGTIRKVTYTADKVNGFNAVVEKKGVAAVA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 19/58 (33%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 20/60 (33%)

Return to query results.
Submit another query.