DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr49Ab

DIOPT Version :9

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:105 Identity:38/105 - (36%)
Similarity:52/105 - (49%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AAPAAEEPT-----------------IVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENE 63
            |.||..:||                 |:|.|.||..:.:.|.|||.:|...:..|::..: ||.|
  Fly   135 APPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKL-TEEE 198

  Fly    64 AISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAP 103
            .:...|.|.:...||..|:|:|:||.|||.|..||||.||
  Fly   199 GLRSKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLPTAP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 19/54 (35%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.