DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Lcp65Ae

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:96 Identity:36/96 - (37%)
Similarity:58/96 - (60%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLVAFLAIGICLAFPAGEDAQAETIKLESENTGDKYSFAYETSNGISRTETGEVK-PGAGEEDGS 70
            :|:.|:||   .||....:||  .|.|||:...:.:.:::|||:|.:....|::| |....|  |
  Fly     3 FLIVFVAI---FAFALANEAQ--IINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHE--S 60

  Fly    71 LSVQGSTSWSAPDGKKYEISFTADETGYHPK 101
            |:||||..:.|.||:.||:::.|||.|:.|:
  Fly    61 LAVQGSFRFVADDGQTYEVNYIADENGFQPQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 22/56 (39%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 22/56 (39%)

Return to query results.
Submit another query.