DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Lcp65Ac

DIOPT Version :9

Sequence 1:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:94 Identity:36/94 - (38%)
Similarity:58/94 - (61%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VAFLAI-GICLAFPAGEDAQAETIKLESENTGDKYSFAYETSNGISRTETGEVKPGAGEEDGSLS 72
            :.|.|: .:.||.|| .||..:.::|||:...:.|:||.|||:|....|.|::| ..|.|..::.
  Fly     7 IVFTALFAVVLAAPA-PDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQLK-NVGTEQEAIV 69

  Fly    73 VQGSTSWSAPDGKKYEISFTADETGYHPK 101
            |:||.|:.|.||:.|.:::.|||.|:.|:
  Fly    70 VRGSYSFVADDGQTYTVNYIADENGFQPE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 23/55 (42%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:278791 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.