DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Cpr65Aw

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:93 Identity:34/93 - (36%)
Similarity:55/93 - (59%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVAFLAIGICLAFPAGEDAQAETIKLESEN-TGDKYSFAYETSNGISRTETGEVK-PGAGEEDGS 70
            |...:.:..|.......|. |:.::.::|| ..|.|:|::|||:||||.|...:| ||..||  :
  Fly     7 LFGLILVSFCACSSNATDT-AQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEE--A 68

  Fly    71 LSVQGSTSWSAPDGKKYEISFTADETGY 98
            :::|||..|..|||..|::::.|||.|:
  Fly    69 IAIQGSVHWVGPDGIHYKLNYLADENGF 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 26/56 (46%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 26/56 (46%)

Return to query results.
Submit another query.