DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Cpr49Af

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:96 Identity:33/96 - (34%)
Similarity:47/96 - (48%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FMWLVAFLAIGICLAFPAGEDAQAETIKLES--ENTGDKYSFAYETSNGISRTETGEVKPGAGEE 67
            ::.|:|...:.      |......:.|..||  |..| ||.:.||..:|...|:.|.:|....:.
  Fly     3 YLMLIALFVVA------ASATDNDDPISQESNVEYNG-KYHYHYELKDGSKATQDGVLKSVNADH 60

  Fly    68 DGSLSVQGSTSWSAPDGKKYEISFTADETGY 98
            :|. ||.|..|:.|.|||.|.:|:||||.||
  Fly    61 NGE-SVNGKYSFVADDGKTYVVSYTADENGY 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 22/55 (40%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 22/55 (40%)

Return to query results.
Submit another query.