DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:77 Identity:26/77 - (33%)
Similarity:40/77 - (51%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AQAETIKLESE-NTG-DKYSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKKYE 88
            |||..::..:: |.| ..||:.|||.|||...|.| |....|.:.....|:|:.|:..|:|.:..
  Fly    65 AQARIVEQNNDVNYGAGSYSYNYETENGIHGEERG-VPVNIGNQQQEEQVEGAYSFITPEGLRVG 128

  Fly    89 ISFTADETGYHP 100
            :.:.||..|:.|
  Fly   129 VKYLADANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 19/55 (35%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 19/55 (35%)

Return to query results.
Submit another query.