DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:65 Identity:20/65 - (30%)
Similarity:35/65 - (53%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYHPKFRLVA 106
            |.|::|:::|..|.|.|.|...:...|..|.|.|...:....|::.|:.:|||:.|:.|..|.::
  Fly    43 YLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLPHVRYIS 107

  Fly   107  106
              Fly   108  107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 17/55 (31%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.