DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Lcp2

DIOPT Version :9

Sequence 1:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001260802.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:97 Identity:24/97 - (24%)
Similarity:46/97 - (47%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FMWLVAFLAIGICLA-FPAGEDAQAETIKLESENTGDKYSFAYETSNGISRTETGEVKPGAGEED 68
            |:.::|.:.:...|| ....:|..|:.:....:...|.:..:..|||||.:..:|         |
  Fly     4 FVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASG---------D 59

  Fly    69 GSLSVQGSTSWSAPDGKKYEISFTADETGYHP 100
            ...::.|:..|.:|:|:..|:.:.|:|.||.|
  Fly    60 AHGNIHGNFGWISPEGEHVEVKYVANENGYQP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 14/55 (25%)
Lcp2NP_001260802.1 Chitin_bind_4 42..89 CDD:278791 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.