DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Cpr11B

DIOPT Version :9

Sequence 1:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:65 Identity:29/65 - (44%)
Similarity:43/65 - (66%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SENTGDKYSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYH 99
            :.:....|:|.::|.|||.|.||||.:  .|...|||.||||.|::..|||:|.:::|||:.|:|
  Fly    78 NSDANGNYNFGFDTGNGIHRDETGEFR--GGWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFH 140

  Fly   100  99
              Fly   141  140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 27/55 (49%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.