DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax2 and Lcp65Ab1

DIOPT Version :9

Sequence 1:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster


Alignment Length:104 Identity:64/104 - (61%)
Similarity:80/104 - (76%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTV-EVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIST 64
            |||.||..||||:|:|.|.: |::|..|:|..:.:|..||||||||..:|||||||||:.||...
  Fly     1 MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVV 65

  Fly    65 HGSFSYVG-PDGQTYTVTYVADENGFQPQGAHLPVAPVA 102
            ||||::|. ..|:.:|:||||||||:|||||||||||||
  Fly    66 HGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPVAPVA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 34/55 (62%)
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:306811 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.