DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax2 and Cpr65Az

DIOPT Version :10

Sequence 1:NP_652660.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:83 Identity:42/83 - (50%)
Similarity:54/83 - (65%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VEVLRSDSNVGID-NYSYAVETSDGTSKSEEGVLKNAGTE-LEAISTHGSFSYVGPDGQTYTVTY 82
            :.:::.:|.|..| :|.|..||.:|....|.|.|||||.| .||.:..|||||..|:||..::||
  Fly   114 IPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTY 178

  Fly    83 VADENGFQPQGAHLPVAP 100
            :||||||||||.|||..|
  Fly   179 IADENGFQPQGDHLPTPP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax2NP_652660.1 Chitin_bind_4 34..89 CDD:459790 29/55 (53%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 29/55 (53%)

Return to query results.
Submit another query.