DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax2 and Lcp65Ac

DIOPT Version :9

Sequence 1:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:102 Identity:60/102 - (58%)
Similarity:74/102 - (72%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIVLFALFAVALAAPT----VEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIST 64
            |||..|||||.||||.    .::||.:|:|..:.|::|:|||||....|:|.|||.|||.|||..
  Fly     6 AIVFTALFAVVLAAPAPDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQEAIVV 70

  Fly    65 HGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAPV 101
            .||:|:|..|||||||.|:||||||||:|||||..|:
  Fly    71 RGSYSFVADDGQTYTVNYIADENGFQPEGAHLPNVPI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 34/54 (63%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:278791 34/54 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.